Total number of results for Piaractus mesopotamicus are 2
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP02416 |
HSEGTFSNDYSKYLETQRAQDFVQWLMNS
|
29 | Piaractus mesopotamicus | Glucagon | Glucagon | 10327603#de Lima J.A., Oliveira B., Conlon J.M.#Purification and characterization of insulin and peptides derived from proglucagon and prosomatostatin from the fruit-eating fish, the pacu Piaractus mesopotamicus.# Comp. Biochem. Physiol. 122B:127-135(1999). | |
| NP02417 |
HADGTYTSDVSAYLQDQAAKDFITWLKSGQPKQE
|
34 | Piaractus mesopotamicus | Glucagon | Glucagon-like peptide | 10327603#de Lima J.A., Oliveira B., Conlon J.M.#Purification and characterization of insulin and peptides derived from proglucagon and prosomatostatin from the fruit-eating fish, the pacu Piaractus mesopotamicus.# Comp. Biochem. Physiol. 122B:127-135(1999). |